PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G077900.1
Common NamePHAVU_006G077900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 179aa    MW: 20721.2 Da    PI: 9.8828
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G077900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.93.1e-141050242
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        +i n+  r  ++ +R++ +lKK +ELS+LC++e++ i++s+
  Phvul.006G077900.1 10 FIANDCARRASYRRRKKSMLKKIKELSTLCGVEACAIVYSP 50
                        799*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.624149IPR002100Transcription factor, MADS-box
CDDcd002666.05E-22276No hitNo description
SuperFamilySSF554551.83E-19482IPR002100Transcription factor, MADS-box
PfamPF003191.6E-131050IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MTGRKVKLAF IANDCARRAS YRRRKKSMLK KIKELSTLCG VEACAIVYSP FDQEPQIWPS  60
ESGVQDVVEK FRTMPEWKKH KMGNQESVME KSIVKGKRKI RKLEEENKEM EITMFMFQCL  120
NSSRVQPQHH MTLADLNLLS SVIEQKLNDI SRMLEITNVT EAPYQPQIQP FVDTNLKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146877.11e-132hypothetical protein PHAVU_006G077900g
TrEMBLV7BQL71e-132V7BQL7_PHAVU; Uncharacterized protein
STRINGGLYMA18G05976.11e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1823856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-43AGAMOUS-like 80